Anti LRP4 pAb (ATL-HPA012300)

Atlas Antibodies

Catalog No.: ATL-HPA012300-25

Protein Description: low density lipoprotein receptor-related protein 4
Gene Name: LRP4
Alternative Gene Name: CLSS, LRP-4, MEGF7, SOST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027253: 94%, ENSRNOG00000015285: 95%
Entrez Gene ID: 4038
Uniprot ID: O75096
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVH
• Gene Sequence: PGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVH
• Gene ID - Mouse: ENSMUSG00000027253
• Gene ID - Rat: ENSRNOG00000015285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRP4 pAb (ATL-HPA012300) – 1 Found

Pevzner, Alexandra; Schoser, Benedikt; Peters, Katja; Cosma, Nicoleta-Carmen; Karakatsani, Andromachi; Schalke, Berthold; Melms, Arthur; Kröger, Stephan. Anti-LRP4 autoantibodies in AChR- and MuSK-antibody-negative myasthenia gravis. Journal Of Neurology. 2012;259(3):427-35.