Anti LRP3 pAb (ATL-HPA041658)

Atlas Antibodies

Catalog No.:
ATL-HPA041658-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LDL receptor related protein 3
Gene Name: LRP3
Alternative Gene Name: hLRp105, LRP-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001802: 99%, ENSRNOG00000011451: 99%
Entrez Gene ID: 4037
Uniprot ID: O75074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
Gene Sequence RLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
Gene ID - Mouse ENSMUSG00000001802
Gene ID - Rat ENSRNOG00000011451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRP3 pAb (ATL-HPA041658)
Datasheet Anti LRP3 pAb (ATL-HPA041658) Datasheet (External Link)
Vendor Page Anti LRP3 pAb (ATL-HPA041658) at Atlas Antibodies

Documents & Links for Anti LRP3 pAb (ATL-HPA041658)
Datasheet Anti LRP3 pAb (ATL-HPA041658) Datasheet (External Link)
Vendor Page Anti LRP3 pAb (ATL-HPA041658)