Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005980-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LRP2
Alternative Gene Name: DBS, gp330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027070: 78%, ENSRNOG00000056184: 78%
Entrez Gene ID: 4036
Uniprot ID: P98164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL |
| Gene Sequence | GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL |
| Gene ID - Mouse | ENSMUSG00000027070 |
| Gene ID - Rat | ENSRNOG00000056184 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) | |
| Datasheet | Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) | |
| Datasheet | Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) |
| Citations for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) – 4 Found |
| Sun, Jia; Hultenby, Kjell; Axelsson, Jonas; Nordström, Johan; He, Bing; Wernerson, Annika; Lindström, Karin. Proximal Tubular Expression Patterns of Megalin and Cubilin in Proteinuric Nephropathies. Kidney International Reports. 2017;2(4):721-732. PubMed |
| Li, Qiong; Wang, Yuchen; Deng, Wenfeng; Liu, Yanna; Geng, Jian; Yan, Ziyan; Li, Fei; Chen, Binshen; Li, Zhuolin; Xia, Renfei; Zeng, Wenli; Liu, Rumin; Xu, Jian; Xiong, Fu; Wu, Chin-Lee; Miao, Yun. Heterogeneity of cell composition and origin identified by single-cell transcriptomics in renal cysts of patients with autosomal dominant polycystic kidney disease. Theranostics. 11(20):10064-10073. PubMed |
| Ma, Li-Jun; Corsa, Bridgette A; Zhou, Jun; Yang, HaiChun; Li, HaiJing; Tang, Yi-Wei; Babaev, Vladimir R; Major, Amy S; Linton, MacRae F; Fazio, Sergio; Hunley, Tracy E; Kon, Valentina; Fogo, Agnes B. Angiotensin type 1 receptor modulates macrophage polarization and renal injury in obesity. American Journal Of Physiology. Renal Physiology. 2011;300(5):F1203-13. PubMed |
| Perez-Gomez, Maria V; Sanchez-Niño, Maria D; Ortiz, Alberto. Megalin/lipoprotein receptor-related protein 2 autoimmunity and kidney disease. Clinical Kidney Journal. 2020;13(3):281-286. PubMed |