Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005980-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor-related protein 2
Gene Name: LRP2
Alternative Gene Name: DBS, gp330
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027070: 78%, ENSRNOG00000056184: 78%
Entrez Gene ID: 4036
Uniprot ID: P98164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL
Gene Sequence GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL
Gene ID - Mouse ENSMUSG00000027070
Gene ID - Rat ENSRNOG00000056184
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation)
Datasheet Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation)
Datasheet Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation)
Citations for Anti LRP2 pAb (ATL-HPA005980 w/enhanced validation) – 4 Found
Sun, Jia; Hultenby, Kjell; Axelsson, Jonas; Nordström, Johan; He, Bing; Wernerson, Annika; Lindström, Karin. Proximal Tubular Expression Patterns of Megalin and Cubilin in Proteinuric Nephropathies. Kidney International Reports. 2017;2(4):721-732.  PubMed
Li, Qiong; Wang, Yuchen; Deng, Wenfeng; Liu, Yanna; Geng, Jian; Yan, Ziyan; Li, Fei; Chen, Binshen; Li, Zhuolin; Xia, Renfei; Zeng, Wenli; Liu, Rumin; Xu, Jian; Xiong, Fu; Wu, Chin-Lee; Miao, Yun. Heterogeneity of cell composition and origin identified by single-cell transcriptomics in renal cysts of patients with autosomal dominant polycystic kidney disease. Theranostics. 11(20):10064-10073.  PubMed
Ma, Li-Jun; Corsa, Bridgette A; Zhou, Jun; Yang, HaiChun; Li, HaiJing; Tang, Yi-Wei; Babaev, Vladimir R; Major, Amy S; Linton, MacRae F; Fazio, Sergio; Hunley, Tracy E; Kon, Valentina; Fogo, Agnes B. Angiotensin type 1 receptor modulates macrophage polarization and renal injury in obesity. American Journal Of Physiology. Renal Physiology. 2011;300(5):F1203-13.  PubMed
Perez-Gomez, Maria V; Sanchez-Niño, Maria D; Ortiz, Alberto. Megalin/lipoprotein receptor-related protein 2 autoimmunity and kidney disease. Clinical Kidney Journal. 2020;13(3):281-286.  PubMed