Anti LRP1 pAb (ATL-HPA004182)

Atlas Antibodies

Catalog No.:
ATL-HPA004182-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor-related protein 1
Gene Name: LRP1
Alternative Gene Name: A2MR, APOER, APR, CD91, LRP, LRP1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040249: 93%, ENSRNOG00000025053: 93%
Entrez Gene ID: 4035
Uniprot ID: Q07954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
Gene Sequence STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
Gene ID - Mouse ENSMUSG00000040249
Gene ID - Rat ENSRNOG00000025053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRP1 pAb (ATL-HPA004182)
Datasheet Anti LRP1 pAb (ATL-HPA004182) Datasheet (External Link)
Vendor Page Anti LRP1 pAb (ATL-HPA004182) at Atlas Antibodies

Documents & Links for Anti LRP1 pAb (ATL-HPA004182)
Datasheet Anti LRP1 pAb (ATL-HPA004182) Datasheet (External Link)
Vendor Page Anti LRP1 pAb (ATL-HPA004182)