Anti LPAR2 pAb (ATL-HPA019616)

Atlas Antibodies

Catalog No.: ATL-HPA019616-25

Protein Description: lysophosphatidic acid receptor 2
Gene Name: LPAR2
Alternative Gene Name: EDG-4, EDG4, LPA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031861: 85%, ENSRNOG00000010758: 87%
Entrez Gene ID: 9170
Uniprot ID: Q9HBW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
• Gene Sequence: LLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
• Gene ID - Mouse: ENSMUSG00000031861
• Gene ID - Rat: ENSRNOG00000010758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LPAR2 pAb (ATL-HPA019616) – 3 Found

Kuriyama, Sei; Theveneau, Eric; Benedetto, Alexandre; Parsons, Maddy; Tanaka, Masamitsu; Charras, Guillaume; Kabla, Alexandre; Mayor, Roberto. In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity. The Journal Of Cell Biology. 2014;206(1):113-27. 

Leve, Fernanda; Peres-Moreira, Rubem J; Binato, Renata; Abdelhay, Eliana; Morgado-Díaz, José A. LPA Induces Colon Cancer Cell Proliferation through a Cooperation between the ROCK and STAT-3 Pathways. Plos One. 10(9):e0139094. 

Hashimoto, Shigeru; Mikami, Shuji; Sugino, Hirokazu; Yoshikawa, Ayumu; Hashimoto, Ari; Onodera, Yasuhito; Furukawa, Shotaro; Handa, Haruka; Oikawa, Tsukasa; Okada, Yasunori; Oya, Mototsugu; Sabe, Hisataka. Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer. Nature Communications. 2016;7( 26854204):10656.