Anti LOX pAb (ATL-HPA043930)

Atlas Antibodies

Catalog No.:
ATL-HPA043930-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lysyl oxidase
Gene Name: LOX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024529: 96%, ENSRNOG00000014426: 94%
Entrez Gene ID: 4015
Uniprot ID: P28300
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRC
Gene Sequence VGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRC
Gene ID - Mouse ENSMUSG00000024529
Gene ID - Rat ENSRNOG00000014426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LOX pAb (ATL-HPA043930)
Datasheet Anti LOX pAb (ATL-HPA043930) Datasheet (External Link)
Vendor Page Anti LOX pAb (ATL-HPA043930) at Atlas Antibodies

Documents & Links for Anti LOX pAb (ATL-HPA043930)
Datasheet Anti LOX pAb (ATL-HPA043930) Datasheet (External Link)
Vendor Page Anti LOX pAb (ATL-HPA043930)