Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002034-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: LONP1
Alternative Gene Name: hLON, LonHS, PIM1, PRSS15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041168: 97%, ENSRNOG00000046502: 97%
Entrez Gene ID: 9361
Uniprot ID: P36776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA |
| Gene Sequence | PAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA |
| Gene ID - Mouse | ENSMUSG00000041168 |
| Gene ID - Rat | ENSRNOG00000046502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) | |
| Datasheet | Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) | |
| Datasheet | Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) |
| Citations for Anti LONP1 pAb (ATL-HPA002034 w/enhanced validation) – 2 Found |
| Gibellini, Lara; Borella, Rebecca; De Gaetano, Anna; Zanini, Giada; Tartaro, Domenico Lo; Carnevale, Gianluca; Beretti, Francesca; Losi, Lorena; De Biasi, Sara; Nasi, Milena; Forcato, Mattia; Cossarizza, Andrea; Pinti, Marcello. Evidence for mitochondrial Lonp1 expression in the nucleus. Scientific Reports. 2022;12(1):10877. PubMed |
| Ferezin, Camila de Castro; Basei, Fernanda Luisa; Melo-Hanchuk, Talita D; de Oliveira, Ana Luisa; Peres de Oliveira, Andressa; Mori, Mateus P; de Souza-Pinto, Nadja C; Kobarg, Jörg. NEK5 interacts with LonP1 and its kinase activity is essential for the regulation of mitochondrial functions and mtDNA maintenance. Febs Open Bio. 2021;11(3):546-563. PubMed |