Anti LIMK2 pAb (ATL-HPA008183)

Atlas Antibodies

Catalog No.:
ATL-HPA008183-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: LIM domain kinase 2
Gene Name: LIMK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020451: 90%, ENSRNOG00000019000: 88%
Entrez Gene ID: 3985
Uniprot ID: P53671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQ
Gene Sequence VEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQ
Gene ID - Mouse ENSMUSG00000020451
Gene ID - Rat ENSRNOG00000019000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LIMK2 pAb (ATL-HPA008183)
Datasheet Anti LIMK2 pAb (ATL-HPA008183) Datasheet (External Link)
Vendor Page Anti LIMK2 pAb (ATL-HPA008183) at Atlas Antibodies

Documents & Links for Anti LIMK2 pAb (ATL-HPA008183)
Datasheet Anti LIMK2 pAb (ATL-HPA008183) Datasheet (External Link)
Vendor Page Anti LIMK2 pAb (ATL-HPA008183)
Citations for Anti LIMK2 pAb (ATL-HPA008183) – 3 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Kim, J-E; Ryu, H J; Kim, M J; Kang, T-C. LIM kinase-2 induces programmed necrotic neuronal death via dysfunction of DRP1-mediated mitochondrial fission. Cell Death And Differentiation. 2014;21(7):1036-49.  PubMed
Basak, Trishita; Ain, Rupasri. Molecular regulation of trophoblast stem cell self-renewal and giant cell differentiation by the Hippo components YAP and LATS1. Stem Cell Research & Therapy. 2022;13(1):189.  PubMed