Anti LIMCH1 pAb (ATL-HPA004184)

Atlas Antibodies

Catalog No.: ATL-HPA004184-25

Protein Description: LIM and calponin homology domains 1
Gene Name: LIMCH1
Alternative Gene Name: DKFZP686A01247, LIMCH1A, LMO7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033060: 22%, ENSRNOG00000007984: 24%
Entrez Gene ID: 22998
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDDLAQQRIQGSLAPHREPPSFITLSNITEADLETWERLKVSEKARDGDVQHICASEPSPEIKAETAIRDDFANRKARASKKASSPRQKFVHFGPVTELDQQKW
• Gene Sequence: HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDDLAQQRIQGSLAPHREPPSFITLSNITEADLETWERLKVSEKARDGDVQHICASEPSPEIKAETAIRDDFANRKARASKKASSPRQKFVHFGPVTELDQQKW
• Gene ID - Mouse: ENSMUSG00000033060
• Gene ID - Rat: ENSRNOG00000007984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LIMCH1 pAb (ATL-HPA004184) – 1 Found

Alifanov, Vladimir Valerievich; Tashireva, Liubov Alexandrovna; Zavyalova, Marina Victorovna; Perelmuter, Vladimir Mikhailovcih. LIMCH1 as a New Potential Metastasis Predictor in Breast Cancer. Asian Pacific Journal Of Cancer Prevention : Apjcp. 2022;23(11):3947-3952.