Anti LHX9 pAb (ATL-HPA009695)

Atlas Antibodies

Catalog No.: ATL-HPA009695-25

Protein Description: LIM homeobox 9
Gene Name: LHX9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019230: 97%, ENSRNOG00000010357: 85%
Entrez Gene ID: 56956
Uniprot ID: Q9NQ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL
• Gene Sequence: GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL
• Gene ID - Mouse: ENSMUSG00000019230
• Gene ID - Rat: ENSRNOG00000010357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LHX9 pAb (ATL-HPA009695) – 1 Found

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25.