Anti LHX9 pAb (ATL-HPA009695)

Atlas Antibodies

Catalog No.:
ATL-HPA009695-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: LIM homeobox 9
Gene Name: LHX9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019230: 97%, ENSRNOG00000010357: 85%
Entrez Gene ID: 56956
Uniprot ID: Q9NQ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL
Gene Sequence GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL
Gene ID - Mouse ENSMUSG00000019230
Gene ID - Rat ENSRNOG00000010357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LHX9 pAb (ATL-HPA009695)
Datasheet Anti LHX9 pAb (ATL-HPA009695) Datasheet (External Link)
Vendor Page Anti LHX9 pAb (ATL-HPA009695) at Atlas Antibodies

Documents & Links for Anti LHX9 pAb (ATL-HPA009695)
Datasheet Anti LHX9 pAb (ATL-HPA009695) Datasheet (External Link)
Vendor Page Anti LHX9 pAb (ATL-HPA009695)
Citations for Anti LHX9 pAb (ATL-HPA009695) – 1 Found
Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25.  PubMed