Anti LEKR1 pAb (ATL-HPA047774)

Atlas Antibodies

Catalog No.:
ATL-HPA047774-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine, glutamate and lysine rich 1
Gene Name: LEKR1
Alternative Gene Name: FLJ16641
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074579: 77%, ENSRNOG00000031247: 74%
Entrez Gene ID: 389170
Uniprot ID: Q6ZMV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG
Gene Sequence MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG
Gene ID - Mouse ENSMUSG00000074579
Gene ID - Rat ENSRNOG00000031247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LEKR1 pAb (ATL-HPA047774)
Datasheet Anti LEKR1 pAb (ATL-HPA047774) Datasheet (External Link)
Vendor Page Anti LEKR1 pAb (ATL-HPA047774) at Atlas Antibodies

Documents & Links for Anti LEKR1 pAb (ATL-HPA047774)
Datasheet Anti LEKR1 pAb (ATL-HPA047774) Datasheet (External Link)
Vendor Page Anti LEKR1 pAb (ATL-HPA047774)