Anti LEKR1 pAb (ATL-HPA047774)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047774-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LEKR1
Alternative Gene Name: FLJ16641
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074579: 77%, ENSRNOG00000031247: 74%
Entrez Gene ID: 389170
Uniprot ID: Q6ZMV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG |
Gene Sequence | MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG |
Gene ID - Mouse | ENSMUSG00000074579 |
Gene ID - Rat | ENSRNOG00000031247 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LEKR1 pAb (ATL-HPA047774) | |
Datasheet | Anti LEKR1 pAb (ATL-HPA047774) Datasheet (External Link) |
Vendor Page | Anti LEKR1 pAb (ATL-HPA047774) at Atlas Antibodies |
Documents & Links for Anti LEKR1 pAb (ATL-HPA047774) | |
Datasheet | Anti LEKR1 pAb (ATL-HPA047774) Datasheet (External Link) |
Vendor Page | Anti LEKR1 pAb (ATL-HPA047774) |