Anti LEFTY1 pAb (ATL-HPA047883)

Atlas Antibodies

Catalog No.:
ATL-HPA047883-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: left-right determination factor 1
Gene Name: LEFTY1
Alternative Gene Name: LEFTB, LEFTYB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038793: 88%, ENSRNOG00000060325: 86%
Entrez Gene ID: 10637
Uniprot ID: O75610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTC
Gene Sequence AQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTC
Gene ID - Mouse ENSMUSG00000038793
Gene ID - Rat ENSRNOG00000060325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LEFTY1 pAb (ATL-HPA047883)
Datasheet Anti LEFTY1 pAb (ATL-HPA047883) Datasheet (External Link)
Vendor Page Anti LEFTY1 pAb (ATL-HPA047883) at Atlas Antibodies

Documents & Links for Anti LEFTY1 pAb (ATL-HPA047883)
Datasheet Anti LEFTY1 pAb (ATL-HPA047883) Datasheet (External Link)
Vendor Page Anti LEFTY1 pAb (ATL-HPA047883)