Anti LDHB pAb (ATL-HPA019007)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019007-100
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/84126/153205/atl-hpa019007_anti-ldhb-pab-atl-hpa019007_34834__93045.1681103302.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: LDHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030246: 98%, ENSRNOG00000013000: 98%
Entrez Gene ID: 3945
Uniprot ID: P07195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Gene Sequence | HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Gene ID - Mouse | ENSMUSG00000030246 |
| Gene ID - Rat | ENSRNOG00000013000 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LDHB pAb (ATL-HPA019007) | |
| Datasheet | Anti LDHB pAb (ATL-HPA019007) Datasheet (External Link) |
| Vendor Page | Anti LDHB pAb (ATL-HPA019007) at Atlas Antibodies |
| Documents & Links for Anti LDHB pAb (ATL-HPA019007) | |
| Datasheet | Anti LDHB pAb (ATL-HPA019007) Datasheet (External Link) |
| Vendor Page | Anti LDHB pAb (ATL-HPA019007) |
| Citations for Anti LDHB pAb (ATL-HPA019007) – 2 Found |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |
| Chidlow, Glyn; Chan, Weng Onn; Wood, John P M; Casson, Robert J. Investigations into photoreceptor energy metabolism during experimental retinal detachment. Frontiers In Cellular Neuroscience. 16( 36467607):1036834. PubMed |