Anti LDB1 pAb (ATL-HPA034488)

Atlas Antibodies

Catalog No.: ATL-HPA034488-25

Protein Description: LIM domain binding 1
Gene Name: LDB1
Alternative Gene Name: CLIM2, NLI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025223: 100%, ENSRNOG00000018468: 100%
Entrez Gene ID: 8861
Uniprot ID: Q86U70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW
• Gene Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW
• Gene ID - Mouse: ENSMUSG00000025223
• Gene ID - Rat: ENSRNOG00000018468
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LDB1 pAb (ATL-HPA034488) – 3 Found

de Melo, Jimmy; Clark, Brian S; Venkataraman, Anand; Shiau, Fion; Zibetti, Cristina; Blackshaw, Seth. Ldb1- and Rnf12-dependent regulation of Lhx2 controls the relative balance between neurogenesis and gliogenesis in the retina. Development (Cambridge, England). 2018;145(9) 

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.