Anti LCN2 pAb (ATL-HPA002695 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002695-25

Protein Description: lipocalin 2
Gene Name: LCN2
Alternative Gene Name: 24p3, NGAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026822: 60%, ENSRNOG00000013973: 63%
Entrez Gene ID: 3934
Uniprot ID: P80188
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
• Gene Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
• Gene ID - Mouse: ENSMUSG00000026822
• Gene ID - Rat: ENSRNOG00000013973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LCN2 pAb (ATL-HPA002695 w/enhanced validation) – 7 Found

Molina, Laura; Bell, Danielle; Tao, Junyan; Preziosi, Morgan; Pradhan-Sundd, Tirthadipa; Singh, Sucha; Poddar, Minakshi; Luo, Jianhua; Ranganathan, Sarangarajan; Chikina, Maria; Monga, Satdarshan P. Hepatocyte-Derived Lipocalin 2 Is a Potential Serum Biomarker Reflecting Tumor Burden in Hepatoblastoma. The American Journal Of Pathology. 2018;188(8):1895-1909. 

Støy, Sidsel; Laursen, Tea Lund; Glavind, Emilie; Eriksen, Peter Lykke; Terczynska-Dyla, Ewa; Magnusson, Nils Erik; Hamilton-Dutoit, Stephen; Mortensen, Frank Viborg; Veidal, Sanne Skovgård; Rigbolt, Kristoffer; Riggio, Oliviero; Deleuran, Bent; Vilstrup, Hendrik; Sandahl, Thomas Damgaard. Low Interleukin-22 Binding Protein Is Associated With High Mortality in Alcoholic Hepatitis and Modulates Interleukin-22 Receptor Expression. Clinical And Translational Gastroenterology. 2020;11(8):e00197. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Rathore, Khizr I; Berard, Jennifer L; Redensek, Adriana; Chierzi, Sabrina; Lopez-Vales, Ruben; Santos, Manuela; Akira, Shizuo; David, Samuel. Lipocalin 2 plays an immunomodulatory role and has detrimental effects after spinal cord injury. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2011;31(38):13412-9. 

McLean, M H; Thomson, A J; Murray, G I; Fyfe, N; Hold, G L; El-Omar, E M. Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression: a marker of malignant potential?. British Journal Of Cancer. 2013;108(12):2537-41. 

Candido, Saverio; Maestro, Roberta; Polesel, Jerry; Catania, Alessia; Maira, Francesca; Signorelli, Santo S; McCubrey, James A; Libra, Massimo. Roles of neutrophil gelatinase-associated lipocalin (NGAL) in human cancer. Oncotarget. 2014;5(6):1576-94. 

Murtha, Matthew J; Eichler, Tad; Bender, Kristin; Metheny, Jackie; Li, Birong; Schwaderer, Andrew L; Mosquera, Claudia; James, Cindy; Schwartz, Laura; Becknell, Brian; Spencer, John David. Insulin receptor signaling regulates renal collecting duct and intercalated cell antibacterial defenses. The Journal Of Clinical Investigation. 2018;128(12):5634-5646.