Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046376-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LCE6A
Alternative Gene Name: C1orf44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086848: 45%, ENSRNOG00000055370: 46%
Entrez Gene ID: 448835
Uniprot ID: A0A183
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD |
Gene Sequence | MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD |
Gene ID - Mouse | ENSMUSG00000086848 |
Gene ID - Rat | ENSRNOG00000055370 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) | |
Datasheet | Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) | |
Datasheet | Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) |
Citations for Anti LCE6A pAb (ATL-HPA046376 w/enhanced validation) – 1 Found |
Boutrand, Laetitia-Barbollat; Thépot, Amélie; Muther, Charlotte; Boher, Aurélie; Robic, Julie; Guéré, Christelle; Vié, Katell; Damour, Odile; Lamartine, Jérôme. Repeated short climatic change affects the epidermal differentiation program and leads to matrix remodeling in a human organotypic skin model. Clinical, Cosmetic And Investigational Dermatology. 10( 28243135):43-50. PubMed |