Anti LAP3 pAb (ATL-HPA029606 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029606-100

Protein Description: leucine aminopeptidase 3
Gene Name: LAP3
Alternative Gene Name: LAP, LAPEP, PEPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039682: 79%, ENSRNOG00000003289: 82%
Entrez Gene ID: 51056
Uniprot ID: P28838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVG
• Gene Sequence: AGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVG
• Gene ID - Mouse: ENSMUSG00000039682
• Gene ID - Rat: ENSRNOG00000003289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.