Anti LAMP2 pAb (ATL-HPA029101)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029101-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LAMP2
Alternative Gene Name: CD107b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016534: 84%, ENSRNOG00000000164: 84%
Entrez Gene ID: 3920
Uniprot ID: P13473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF |
| Gene Sequence | LGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF |
| Gene ID - Mouse | ENSMUSG00000016534 |
| Gene ID - Rat | ENSRNOG00000000164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LAMP2 pAb (ATL-HPA029101) | |
| Datasheet | Anti LAMP2 pAb (ATL-HPA029101) Datasheet (External Link) |
| Vendor Page | Anti LAMP2 pAb (ATL-HPA029101) at Atlas Antibodies |
| Documents & Links for Anti LAMP2 pAb (ATL-HPA029101) | |
| Datasheet | Anti LAMP2 pAb (ATL-HPA029101) Datasheet (External Link) |
| Vendor Page | Anti LAMP2 pAb (ATL-HPA029101) |