Anti LAMP2 pAb (ATL-HPA029101)

Atlas Antibodies

Catalog No.:
ATL-HPA029101-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lysosomal associated membrane protein 2
Gene Name: LAMP2
Alternative Gene Name: CD107b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016534: 84%, ENSRNOG00000000164: 84%
Entrez Gene ID: 3920
Uniprot ID: P13473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF
Gene Sequence LGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF
Gene ID - Mouse ENSMUSG00000016534
Gene ID - Rat ENSRNOG00000000164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LAMP2 pAb (ATL-HPA029101)
Datasheet Anti LAMP2 pAb (ATL-HPA029101) Datasheet (External Link)
Vendor Page Anti LAMP2 pAb (ATL-HPA029101) at Atlas Antibodies

Documents & Links for Anti LAMP2 pAb (ATL-HPA029101)
Datasheet Anti LAMP2 pAb (ATL-HPA029101) Datasheet (External Link)
Vendor Page Anti LAMP2 pAb (ATL-HPA029101)