Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029100-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LAMP2
Alternative Gene Name: CD107b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016534: 44%, ENSRNOG00000000164: 46%
Entrez Gene ID: 3920
Uniprot ID: P13473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV |
Gene Sequence | ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV |
Gene ID - Mouse | ENSMUSG00000016534 |
Gene ID - Rat | ENSRNOG00000000164 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) | |
Datasheet | Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) | |
Datasheet | Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) |
Citations for Anti LAMP2 pAb (ATL-HPA029100 w/enhanced validation) – 3 Found |
Avnet, Sofia; Di Pompo, Gemma; Chano, Tokuhiro; Errani, Costantino; Ibrahim-Hashim, Arig; Gillies, Robert J; Donati, Davide Maria; Baldini, Nicola. Cancer-associated mesenchymal stroma fosters the stemness of osteosarcoma cells in response to intratumoral acidosis via NF-κB activation. International Journal Of Cancer. 2017;140(6):1331-1345. PubMed |
Di Pompo, Gemma; Lemma, Silvia; Canti, Lorenzo; Rucci, Nadia; Ponzetti, Marco; Errani, Costantino; Donati, Davide Maria; Russell, Shonagh; Gillies, Robert; Chano, Tokuhiro; Baldini, Nicola; Avnet, Sofia. Intratumoral acidosis fosters cancer-induced bone pain through the activation of the mesenchymal tumor-associated stroma in bone metastasis from breast carcinoma. Oncotarget. 2017;8(33):54478-54496. PubMed |
Cortini, Margherita; Armirotti, Andrea; Columbaro, Marta; Longo, Dario Livio; Di Pompo, Gemma; Cannas, Elena; Maresca, Alessandra; Errani, Costantino; Longhi, Alessandra; Righi, Alberto; Carelli, Valerio; Baldini, Nicola; Avnet, Sofia. Exploring Metabolic Adaptations to the Acidic Microenvironment of Osteosarcoma Cells Unveils Sphingosine 1-Phosphate as a Valuable Therapeutic Target. Cancers. 2021;13(2) PubMed |