Anti LAMB4 pAb (ATL-HPA020242)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020242-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LAMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034485: 26%, ENSRNOG00000057880: 25%
Entrez Gene ID: 22798
Uniprot ID: A4D0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VANGVLDIHLPIPSQNLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAEKAANILLNLDKTLNQLQQAQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELELAKQRSG |
Gene ID - Mouse | ENSMUSG00000034485 |
Gene ID - Rat | ENSMUSG00000034485 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LAMB4 pAb (ATL-HPA020242) | |
Datasheet | Anti LAMB4 pAb (ATL-HPA020242) Datasheet (External Link) |
Vendor Page | Anti LAMB4 pAb (ATL-HPA020242) at Atlas Antibodies |
Documents & Links for Anti LAMB4 pAb (ATL-HPA020242) | |
Datasheet | Anti LAMB4 pAb (ATL-HPA020242) Datasheet (External Link) |
Vendor Page | Anti LAMB4 pAb (ATL-HPA020242) |