Anti LAMB4 pAb (ATL-HPA020242)

Atlas Antibodies

Catalog No.: ATL-HPA020242-25

Protein Description: laminin, beta 4
Gene Name: LAMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034485: 26%, ENSRNOG00000057880: 25%
Entrez Gene ID: 22798
Uniprot ID: A4D0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: VANGVLDIHLPIPSQNLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAEKAANILLNLDKTLNQLQQAQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELELAKQRSG
• Gene ID - Mouse: ENSMUSG00000034485
• Gene ID - Rat: ENSMUSG00000034485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.