Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011155-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: leukocyte-associated immunoglobulin-like receptor 1
Gene Name: LAIR1
Alternative Gene Name: CD305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055541: 52%, ENSRNOG00000027733: 51%
Entrez Gene ID: 3903
Uniprot ID: Q6GTX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Gene Sequence HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Gene ID - Mouse ENSMUSG00000055541
Gene ID - Rat ENSRNOG00000027733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation)
Datasheet Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation)
Datasheet Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation)
Citations for Anti LAIR1 pAb (ATL-HPA011155 w/enhanced validation) – 3 Found
Ramos, M Ines Pascoal; Tian, Linjie; de Ruiter, Emma J; Song, Chang; Paucarmayta, Ana; Singh, Akashdip; Elshof, Eline; Vijver, Saskia V; Shaik, Jahangheer; Bosiacki, Jason; Cusumano, Zachary; Jensen, Christina; Willumsen, Nicholas; Karsdal, Morten A; Liu, Linda; Langermann, Sol; Willems, Stefan; Flies, Dallas; Meyaard, Linde. Cancer immunotherapy by NC410, a LAIR-2 Fc protein blocking human LAIR-collagen interaction. Elife. 2021;10( 34121658)  PubMed
Son, Myoungsun; Diamond, Betty; Volpe, Bruce T; Aranow, Cynthia B; Mackay, Meggan C; Santiago-Schwarz, Frances. Evidence for C1q-mediated crosslinking of CD33/LAIR-1 inhibitory immunoreceptors and biological control of CD33/LAIR-1 expression. Scientific Reports. 2017;7(1):270.  PubMed
Ho, Daniel Wai-Hung; Tsui, Yu-Man; Chan, Lo-Kong; Sze, Karen Man-Fong; Zhang, Xin; Cheu, Jacinth Wing-Sum; Chiu, Yung-Tuen; Lee, Joyce Man-Fong; Chan, Albert Chi-Yan; Cheung, Elaine Tin-Yan; Yau, Derek Tsz-Wai; Chia, Nam-Hung; Lo, Irene Lai-Oi; Sham, Pak-Chung; Cheung, Tan-To; Wong, Carmen Chak-Lui; Ng, Irene Oi-Lin. Single-cell RNA sequencing shows the immunosuppressive landscape and tumor heterogeneity of HBV-associated hepatocellular carcinoma. Nature Communications. 2021;12(1):3684.  PubMed