Anti LAD1 pAb (ATL-HPA028732 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028732-25

Protein Description: ladinin 1
Gene Name: LAD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041782: 51%, ENSRNOG00000009144: 52%
Entrez Gene ID: 3898
Uniprot ID: O00515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAP
• Gene Sequence: EEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAP
• Gene ID - Mouse: ENSMUSG00000041782
• Gene ID - Rat: ENSRNOG00000009144
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LAD1 pAb (ATL-HPA028732 w/enhanced validation) – 1 Found

Roth, Lee; Srivastava, Swati; Lindzen, Moshit; Sas-Chen, Aldema; Sheffer, Michal; Lauriola, Mattia; Enuka, Yehoshua; Noronha, Ashish; Mancini, Maicol; Lavi, Sara; Tarcic, Gabi; Pines, Gur; Nevo, Nava; Heyman, Ori; Ziv, Tamar; Rueda, Oscar M; Gnocchi, Davide; Pikarsky, Eli; Admon, Arie; Caldas, Carlos; Yarden, Yosef. SILAC identifies LAD1 as a filamin-binding regulator of actin dynamics in response to EGF and a marker of aggressive breast tumors. Science Signaling. 2018;11(515)