Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026538-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: kynurenine aminotransferase 3
Gene Name: KYAT3
Alternative Gene Name: CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040213: 92%, ENSRNOG00000043426: 82%
Entrez Gene ID: 56267
Uniprot ID: Q6YP21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
Gene Sequence VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
Gene ID - Mouse ENSMUSG00000040213
Gene ID - Rat ENSRNOG00000043426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation)
Datasheet Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation)
Datasheet Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation)
Citations for Anti KYAT3 pAb (ATL-HPA026538 w/enhanced validation) – 1 Found
Gosker, Harry R; Clarke, Gerard; de Theije, Chiel C; Cryan, John F; Schols, Annemie M W J. Impaired Skeletal Muscle Kynurenine Metabolism in Patients with Chronic Obstructive Pulmonary Disease. Journal Of Clinical Medicine. 2019;8(7)  PubMed