Anti KTI12 pAb (ATL-HPA031203)

Atlas Antibodies

Catalog No.: ATL-HPA031203-25

Protein Description: KTI12 chromatin associated homolog
Gene Name: KTI12
Alternative Gene Name: MGC20419, SBBI81, TOT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073775: 87%, ENSRNOG00000029662: 27%
Entrez Gene ID: 112970
Uniprot ID: Q96EK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQVTSQVLAGLMEAQKSAVPGGLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQ
• Gene Sequence: DQVTSQVLAGLMEAQKSAVPGGLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQ
• Gene ID - Mouse: ENSMUSG00000073775
• Gene ID - Rat: ENSRNOG00000029662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.