Anti KSR2 pAb (ATL-HPA035536)

Atlas Antibodies

Catalog No.: ATL-HPA035536-25

Protein Description: kinase suppressor of ras 2
Gene Name: KSR2
Alternative Gene Name: FLJ25965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061578: 95%, ENSRNOG00000028630: 96%
Entrez Gene ID: 283455
Uniprot ID: Q6VAB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLS
• Gene Sequence: LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLS
• Gene ID - Mouse: ENSMUSG00000061578
• Gene ID - Rat: ENSRNOG00000028630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.