Anti KRTAP24-1 pAb (ATL-HPA017604)

Atlas Antibodies

Catalog No.:
ATL-HPA017604-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: keratin associated protein 24-1
Gene Name: KRTAP24-1
Alternative Gene Name: KAP24.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050239: 67%, ENSRNOG00000048374: 67%
Entrez Gene ID: 643803
Uniprot ID: Q3LI83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSDLSPTFGHCLPSSYQGNLWLLDYCQESYGEAPTCKSPS
Gene Sequence GSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSDLSPTFGHCLPSSYQGNLWLLDYCQESYGEAPTCKSPS
Gene ID - Mouse ENSMUSG00000050239
Gene ID - Rat ENSRNOG00000048374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRTAP24-1 pAb (ATL-HPA017604)
Datasheet Anti KRTAP24-1 pAb (ATL-HPA017604) Datasheet (External Link)
Vendor Page Anti KRTAP24-1 pAb (ATL-HPA017604) at Atlas Antibodies

Documents & Links for Anti KRTAP24-1 pAb (ATL-HPA017604)
Datasheet Anti KRTAP24-1 pAb (ATL-HPA017604) Datasheet (External Link)
Vendor Page Anti KRTAP24-1 pAb (ATL-HPA017604)