Anti KRT81 pAb (ATL-HPA049778)

Atlas Antibodies

Catalog No.:
ATL-HPA049778-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: keratin 81, type II
Gene Name: KRT81
Alternative Gene Name: Hb-1, KRTHB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047641: 94%, ENSRNOG00000036871: 91%
Entrez Gene ID: 3887
Uniprot ID: Q14533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
Gene Sequence AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
Gene ID - Mouse ENSMUSG00000047641
Gene ID - Rat ENSRNOG00000036871
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT81 pAb (ATL-HPA049778)
Datasheet Anti KRT81 pAb (ATL-HPA049778) Datasheet (External Link)
Vendor Page Anti KRT81 pAb (ATL-HPA049778) at Atlas Antibodies

Documents & Links for Anti KRT81 pAb (ATL-HPA049778)
Datasheet Anti KRT81 pAb (ATL-HPA049778) Datasheet (External Link)
Vendor Page Anti KRT81 pAb (ATL-HPA049778)