Anti KRT81 pAb (ATL-HPA049778)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049778-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KRT81
Alternative Gene Name: Hb-1, KRTHB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047641: 94%, ENSRNOG00000036871: 91%
Entrez Gene ID: 3887
Uniprot ID: Q14533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AESWYRSKCEEMKATVIRHGETLRRTKEEINELN |
Gene Sequence | AESWYRSKCEEMKATVIRHGETLRRTKEEINELN |
Gene ID - Mouse | ENSMUSG00000047641 |
Gene ID - Rat | ENSRNOG00000036871 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KRT81 pAb (ATL-HPA049778) | |
Datasheet | Anti KRT81 pAb (ATL-HPA049778) Datasheet (External Link) |
Vendor Page | Anti KRT81 pAb (ATL-HPA049778) at Atlas Antibodies |
Documents & Links for Anti KRT81 pAb (ATL-HPA049778) | |
Datasheet | Anti KRT81 pAb (ATL-HPA049778) Datasheet (External Link) |
Vendor Page | Anti KRT81 pAb (ATL-HPA049778) |