Anti KRT81 pAb (ATL-HPA049778)

Atlas Antibodies

Catalog No.: ATL-HPA049778-25

Protein Description: keratin 81, type II
Gene Name: KRT81
Alternative Gene Name: Hb-1, KRTHB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047641: 94%, ENSRNOG00000036871: 91%
Entrez Gene ID: 3887
Uniprot ID: Q14533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
• Gene Sequence: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
• Gene ID - Mouse: ENSMUSG00000047641
• Gene ID - Rat: ENSRNOG00000036871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.