Anti KRT14 pAb (ATL-HPA023040 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023040-25

Protein Description: keratin 14
Gene Name: KRT14
Alternative Gene Name: EBS3, EBS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045545: 88%, ENSRNOG00000026371: 88%
Entrez Gene ID: 3861
Uniprot ID: P02533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
• Gene Sequence: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
• Gene ID - Mouse: ENSMUSG00000045545
• Gene ID - Rat: ENSRNOG00000026371
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KRT14 pAb (ATL-HPA023040 w/enhanced validation) – 3 Found

Rachinger, Nicole; Mittag, Nora; Böhme-Schäfer, Ines; Xiang, Wei; Kuphal, Silke; Bosserhoff, Anja K. Alpha-Synuclein and Its Role in Melanocytes. Cells. 2022;11(13) 

Itami, Yoshitaka; Miyake, Makito; Ohnishi, Sayuri; Tatsumi, Yoshihiro; Gotoh, Daisuke; Hori, Shunta; Morizawa, Yosuke; Iida, Kota; Ohnishi, Kenta; Nakai, Yasushi; Inoue, Takeshi; Anai, Satoshi; Tanaka, Nobumichi; Fujii, Tomomi; Shimada, Keiji; Furuya, Hideki; Khadka, Vedbar S; Deng, Youping; Fujimoto, Kiyohide. Disabled Homolog 2 (DAB2) Protein in Tumor Microenvironment Correlates with Aggressive Phenotype in Human Urothelial Carcinoma of the Bladder. Diagnostics (Basel, Switzerland). 2020;10(1) 

Leikeim, Anna; Wußmann, Maximiliane; Schmidt, Freia F; Neto, Nuno G B; Benz, Franziska; Tiltmann, Kendra; Junger, Corinna; Monaghan, Michael G; Schilling, Bastian; Groeber-Becker, Florian K. A preclinical model of cutaneous melanoma based on reconstructed human epidermis. Scientific Reports. 2022;12(1):16269.