Anti KRCC1 pAb (ATL-HPA045618)

Atlas Antibodies

Catalog No.:
ATL-HPA045618-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lysine-rich coiled-coil 1
Gene Name: KRCC1
Alternative Gene Name: FLJ22333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053012: 68%, ENSRNOG00000007124: 65%
Entrez Gene ID: 51315
Uniprot ID: Q9NPI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLS
Gene Sequence CFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLS
Gene ID - Mouse ENSMUSG00000053012
Gene ID - Rat ENSRNOG00000007124
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRCC1 pAb (ATL-HPA045618)
Datasheet Anti KRCC1 pAb (ATL-HPA045618) Datasheet (External Link)
Vendor Page Anti KRCC1 pAb (ATL-HPA045618) at Atlas Antibodies

Documents & Links for Anti KRCC1 pAb (ATL-HPA045618)
Datasheet Anti KRCC1 pAb (ATL-HPA045618) Datasheet (External Link)
Vendor Page Anti KRCC1 pAb (ATL-HPA045618)