Anti KRBOX1 pAb (ATL-HPA046901)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046901-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KRBOX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034387: 28%, ENSRNOG00000002272: 25%
Entrez Gene ID: 100506243
Uniprot ID: C9JBD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDR |
| Gene Sequence | YEAVAFVVPPTSKPALVSHLEQGKESCFTQPQGVLSRNDWRAGWIGYLELRRYTYLAKAVLRRIVSKIFRNRQCWEDR |
| Gene ID - Mouse | ENSMUSG00000034387 |
| Gene ID - Rat | ENSRNOG00000002272 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KRBOX1 pAb (ATL-HPA046901) | |
| Datasheet | Anti KRBOX1 pAb (ATL-HPA046901) Datasheet (External Link) |
| Vendor Page | Anti KRBOX1 pAb (ATL-HPA046901) at Atlas Antibodies |
| Documents & Links for Anti KRBOX1 pAb (ATL-HPA046901) | |
| Datasheet | Anti KRBOX1 pAb (ATL-HPA046901) Datasheet (External Link) |
| Vendor Page | Anti KRBOX1 pAb (ATL-HPA046901) |