Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045500-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: karyopherin alpha 4 (importin alpha 3)
Gene Name: KPNA4
Alternative Gene Name: IPOA3, MGC12217, MGC26703, QIP1, SRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027782: 97%, ENSRNOG00000010768: 97%
Entrez Gene ID: 3840
Uniprot ID: O00629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
Gene Sequence KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
Gene ID - Mouse ENSMUSG00000027782
Gene ID - Rat ENSRNOG00000010768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation)
Datasheet Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation)
Datasheet Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation)