Anti KPNA4 pAb (ATL-HPA045500 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045500-100

Protein Description: karyopherin alpha 4 (importin alpha 3)
Gene Name: KPNA4
Alternative Gene Name: IPOA3, MGC12217, MGC26703, QIP1, SRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027782: 97%, ENSRNOG00000010768: 97%
Entrez Gene ID: 3840
Uniprot ID: O00629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
• Gene Sequence: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
• Gene ID - Mouse: ENSMUSG00000027782
• Gene ID - Rat: ENSRNOG00000010768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.