Anti KPNA2 pAb (ATL-HPA041270 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041270-25

Protein Description: karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
Gene Name: KPNA2
Alternative Gene Name: IPOA1, QIP2, RCH1, SRP1alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066878: 92%, ENSRNOG00000030058: 94%
Entrez Gene ID: 3838
Uniprot ID: P52292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL
• Gene Sequence: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL
• Gene ID - Mouse: ENSMUSG00000066878
• Gene ID - Rat: ENSRNOG00000030058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KPNA2 pAb (ATL-HPA041270 w/enhanced validation) – 1 Found

Zhang, Jinzhong; Zhang, Xiuzhi; Wang, Lingxiao; Kang, Chunyan; Li, Ningning; Xiao, Zhefeng; Dai, Liping. Multiomics-based analyses of KPNA2 highlight its multiple potentials in hepatocellular carcinoma. Peerj. 9( 34616632):e12197.