Anti KNTC1 pAb (ATL-HPA025241)

Atlas Antibodies

Catalog No.: ATL-HPA025241-25

Protein Description: kinetochore associated 1
Gene Name: KNTC1
Alternative Gene Name: KIAA0166, ROD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029414: 81%, ENSRNOG00000033658: 81%
Entrez Gene ID: 9735
Uniprot ID: P50748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRTVPEGQIILAKWLEQAARNLELTDKANWPENGLQLAEIFFTAEKTDELGLASSWHWISLKDYQNTEEVCQLRTLVNNLR
• Gene Sequence: VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRTVPEGQIILAKWLEQAARNLELTDKANWPENGLQLAEIFFTAEKTDELGLASSWHWISLKDYQNTEEVCQLRTLVNNLR
• Gene ID - Mouse: ENSMUSG00000029414
• Gene ID - Rat: ENSRNOG00000033658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KNTC1 pAb (ATL-HPA025241) – 1 Found

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162.