Anti KLK3 pAb (ATL-HPA000764)

Atlas Antibodies

Catalog No.: ATL-HPA000764-25

Protein Description: kallikrein-related peptidase 3
Gene Name: KLK3
Alternative Gene Name: APS, PSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044485: 63%, ENSRNOG00000032857: 62%
Entrez Gene ID: 354
Uniprot ID: P07288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
• Gene Sequence: SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
• Gene ID - Mouse: ENSMUSG00000044485
• Gene ID - Rat: ENSRNOG00000032857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KLK3 pAb (ATL-HPA000764) – 4 Found

Okato, Atsushi; Goto, Yusuke; Kurozumi, Akira; Kato, Mayuko; Kojima, Satoko; Matsushita, Ryosuke; Yonemori, Masaya; Miyamoto, Kazutaka; Ichikawa, Tomohiko; Seki, Naohiko. Direct regulation of LAMP1 by tumor-suppressive microRNA-320a in prostate cancer. International Journal Of Oncology. 2016;49(1):111-22. 

Barfeld, Stefan J; Urbanucci, Alfonso; Itkonen, Harri M; Fazli, Ladan; Hicks, Jessica L; Thiede, Bernd; Rennie, Paul S; Yegnasubramanian, Srinivasan; DeMarzo, Angelo M; Mills, Ian G. c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks. Ebiomedicine. 2017;18( 28412251):83-93. 

Jaraj, Sara Jonmarker; Augsten, Martin; Häggarth, Lars; Wester, Kenneth; Pontén, Fredrik; Ostman, Arne; Egevad, Lars. GAD1 is a biomarker for benign and malignant prostatic tissue. Scandinavian Journal Of Urology And Nephrology. 2011;45(1):39-45. 

Liu, H; Zhang, W; Jia, Y; Yu, Q; Grau, G E; Peng, L; Ran, Y; Yang, Z; Deng, H; Lou, J. Single-cell clones of liver cancer stem cells have the potential of differentiating into different types of tumor cells. Cell Death & Disease. 2013;4(10):e857.