Anti KLHL9 pAb (ATL-HPA046039)

Atlas Antibodies

Catalog No.: ATL-HPA046039-25

Protein Description: kelch-like family member 9
Gene Name: KLHL9
Alternative Gene Name: FLJ13568, KIAA1354
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070923: 100%, ENSRNOG00000006335: 100%
Entrez Gene ID: 55958
Uniprot ID: Q9P2J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNE
• Gene Sequence: RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNE
• Gene ID - Mouse: ENSMUSG00000070923
• Gene ID - Rat: ENSRNOG00000006335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.