Anti KLHL9 pAb (ATL-HPA046039)

Atlas Antibodies

SKU:
ATL-HPA046039-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells and smooth muscle cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 9
Gene Name: KLHL9
Alternative Gene Name: FLJ13568, KIAA1354
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070923: 100%, ENSRNOG00000006335: 100%
Entrez Gene ID: 55958
Uniprot ID: Q9P2J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNE
Gene Sequence RYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNE
Gene ID - Mouse ENSMUSG00000070923
Gene ID - Rat ENSRNOG00000006335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLHL9 pAb (ATL-HPA046039)
Datasheet Anti KLHL9 pAb (ATL-HPA046039) Datasheet (External Link)
Vendor Page Anti KLHL9 pAb (ATL-HPA046039) at Atlas Antibodies

Documents & Links for Anti KLHL9 pAb (ATL-HPA046039)
Datasheet Anti KLHL9 pAb (ATL-HPA046039) Datasheet (External Link)
Vendor Page Anti KLHL9 pAb (ATL-HPA046039)