Anti KLHDC4 pAb (ATL-HPA041665)

Atlas Antibodies

Catalog No.: ATL-HPA041665-25

Protein Description: kelch domain containing 4
Gene Name: KLHDC4
Alternative Gene Name: DKFZp434G0522
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040263: 87%, ENSRNOG00000017503: 26%
Entrez Gene ID: 54758
Uniprot ID: Q8TBB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEDLEALIAHFQTLDAKRTQTVELPCPPPSPRLNASLSVHPEKDELILFGGEYFNGQKTFLYNELYVYNTR
• Gene Sequence: EEDLEALIAHFQTLDAKRTQTVELPCPPPSPRLNASLSVHPEKDELILFGGEYFNGQKTFLYNELYVYNTR
• Gene ID - Mouse: ENSMUSG00000040263
• Gene ID - Rat: ENSRNOG00000017503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KLHDC4 pAb (ATL-HPA041665) – 1 Found

Lian, Yi-Fan; Yuan, Jing; Cui, Qian; Feng, Qi-Sheng; Xu, Miao; Bei, Jin-Xin; Zeng, Yi-Xin; Feng, Lin. Upregulation of KLHDC4 Predicts a Poor Prognosis in Human Nasopharyngeal Carcinoma. Plos One. 11(3):e0152820.