Anti KLF5 pAb (ATL-HPA040398)

Atlas Antibodies

Catalog No.: ATL-HPA040398-25

Protein Description: Kruppel-like factor 5 (intestinal)
Gene Name: KLF5
Alternative Gene Name: BTEB2, CKLF, IKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005148: 93%, ENSRNOG00000008785: 96%
Entrez Gene ID: 688
Uniprot ID: Q13887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
• Gene Sequence: TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
• Gene ID - Mouse: ENSMUSG00000005148
• Gene ID - Rat: ENSRNOG00000008785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KLF5 pAb (ATL-HPA040398) – 5 Found

Zimmerlin, Ludovic; Park, Tea Soon; Huo, Jeffrey S; Verma, Karan; Pather, Sarshan R; Talbot, C Conover Jr; Agarwal, Jasmin; Steppan, Diana; Zhang, Yang W; Considine, Michael; Guo, Hong; Zhong, Xiufeng; Gutierrez, Christian; Cope, Leslie; Canto-Soler, M Valeria; Friedman, Alan D; Baylin, Stephen B; Zambidis, Elias T. Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality. Development (Cambridge, England). 2016;143(23):4368-4380. 

Fu, Rong-Jie; He, Wei; Wang, Xiao-Bo; Li, Lei; Zhao, Huan-Bin; Liu, Xiao-Ye; Pang, Zhi; Chen, Guo-Qiang; Huang, Lei; Zhao, Ke-Wen. DNMT1-maintained hypermethylation of Krüppel-like factor 5 involves in the progression of clear cell renal cell carcinoma. Cell Death & Disease. 2017;8(7):e2952. 

Huang, Kang-Bo; Guo, Sheng-Jie; Li, Yong-Hong; Zhang, Xin-Ke; Chen, Dong; Spiess, Philippe E; Li, Zai-Shang; Deng, Chuang-Zhong; Chen, Jie-Ping; Zhou, Qiang-Hua; Hu, Zheng; Ma, Xin; Jin, Jie-Tian; Cao, Yun; Luo, Jun-Hang; Wang, Xiao-Bin; Zhou, Fang-Jian; Liu, Ran-Yi; Han, Hui. Genome-Wide Profiling Reveals HPV Integration Pattern and Activated Carcinogenic Pathways in Penile Squamous Cell Carcinoma. Cancers. 2021;13(23) 

Siraj, Abdul K; Pratheeshkumar, Poyil; Divya, Sasidharan Padmaja; Parvathareddy, Sandeep Kumar; Alobaisi, Khadija A; Thangavel, Saravanan; Siraj, Sarah; Al-Badawi, Ismail A; Al-Dayel, Fouad; Al-Kuraya, Khawla S. Krupple-Like Factor 5 is a Potential Therapeutic Target and Prognostic Marker in Epithelial Ovarian Cancer. Frontiers In Pharmacology. 11( 33424607):598880. 

Pratheeshkumar, Poyil; Siraj, Abdul K; Divya, Sasidharan Padmaja; Parvathareddy, Sandeep Kumar; Siraj, Sarah; Diaz, Roxanne; Begum, Rafia; Al-Sobhi, Saif S; Al-Dayel, Fouad; Al-Kuraya, Khawla S. Prognostic Value and Function of KLF5 in Papillary Thyroid Cancer. Cancers. 2021;13(2)