Anti KLC1 pAb (ATL-HPA052450)

Atlas Antibodies

SKU: ATL-HPA052450-25

• 
• 

Protein Description: kinesin light chain 1
Gene Name: KLC1
Alternative Gene Name: hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021288: 97%, ENSRNOG00000011572: 97%
Entrez Gene ID: 3831
Uniprot ID: Q07866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
• Gene Sequence: EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
• Gene ID - Mouse: ENSMUSG00000021288
• Gene ID - Rat: ENSRNOG00000011572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.