Anti KLC1 pAb (ATL-HPA052450)

Atlas Antibodies

Catalog No.:
ATL-HPA052450-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kinesin light chain 1
Gene Name: KLC1
Alternative Gene Name: hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021288: 97%, ENSRNOG00000011572: 97%
Entrez Gene ID: 3831
Uniprot ID: Q07866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
Gene Sequence EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
Gene ID - Mouse ENSMUSG00000021288
Gene ID - Rat ENSRNOG00000011572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLC1 pAb (ATL-HPA052450)
Datasheet Anti KLC1 pAb (ATL-HPA052450) Datasheet (External Link)
Vendor Page Anti KLC1 pAb (ATL-HPA052450) at Atlas Antibodies

Documents & Links for Anti KLC1 pAb (ATL-HPA052450)
Datasheet Anti KLC1 pAb (ATL-HPA052450) Datasheet (External Link)
Vendor Page Anti KLC1 pAb (ATL-HPA052450)