Anti KLC1 pAb (ATL-HPA052450)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052450-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KLC1
Alternative Gene Name: hKLC1B, hKLC1G, hKLC1J, hKLC1N, hKLC1P, hKLC1R, hKLC1S, KLC, KNS2, KNS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021288: 97%, ENSRNOG00000011572: 97%
Entrez Gene ID: 3831
Uniprot ID: Q07866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG |
| Gene Sequence | EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG |
| Gene ID - Mouse | ENSMUSG00000021288 |
| Gene ID - Rat | ENSRNOG00000011572 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KLC1 pAb (ATL-HPA052450) | |
| Datasheet | Anti KLC1 pAb (ATL-HPA052450) Datasheet (External Link) |
| Vendor Page | Anti KLC1 pAb (ATL-HPA052450) at Atlas Antibodies |
| Documents & Links for Anti KLC1 pAb (ATL-HPA052450) | |
| Datasheet | Anti KLC1 pAb (ATL-HPA052450) Datasheet (External Link) |
| Vendor Page | Anti KLC1 pAb (ATL-HPA052450) |