Anti KIN pAb (ATL-HPA038700)

Atlas Antibodies

Catalog No.:
ATL-HPA038700-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Kin17 DNA and RNA binding protein
Gene Name: KIN
Alternative Gene Name: KIN17, Rts2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037262: 82%, ENSRNOG00000026690: 85%
Entrez Gene ID: 22944
Uniprot ID: O60870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESS
Gene Sequence IEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTLGPSALKTIGSSASVKRKESS
Gene ID - Mouse ENSMUSG00000037262
Gene ID - Rat ENSRNOG00000026690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIN pAb (ATL-HPA038700)
Datasheet Anti KIN pAb (ATL-HPA038700) Datasheet (External Link)
Vendor Page Anti KIN pAb (ATL-HPA038700) at Atlas Antibodies

Documents & Links for Anti KIN pAb (ATL-HPA038700)
Datasheet Anti KIN pAb (ATL-HPA038700) Datasheet (External Link)
Vendor Page Anti KIN pAb (ATL-HPA038700)