Anti KIF23 pAb (ATL-HPA045208)

Atlas Antibodies

Catalog No.:
ATL-HPA045208-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kinesin family member 23
Gene Name: KIF23
Alternative Gene Name: KNSL5, MKLP-1, MKLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032254: 77%, ENSRNOG00000014080: 79%
Entrez Gene ID: 9493
Uniprot ID: Q02241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLN
Gene Sequence FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLN
Gene ID - Mouse ENSMUSG00000032254
Gene ID - Rat ENSRNOG00000014080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF23 pAb (ATL-HPA045208)
Datasheet Anti KIF23 pAb (ATL-HPA045208) Datasheet (External Link)
Vendor Page Anti KIF23 pAb (ATL-HPA045208) at Atlas Antibodies

Documents & Links for Anti KIF23 pAb (ATL-HPA045208)
Datasheet Anti KIF23 pAb (ATL-HPA045208) Datasheet (External Link)
Vendor Page Anti KIF23 pAb (ATL-HPA045208)
Citations for Anti KIF23 pAb (ATL-HPA045208) – 1 Found
Gul, Nadia; Karlsson, Joakim; Tängemo, Carolina; Linsefors, Sanna; Tuyizere, Samuel; Perkins, Rosie; Ala, Chandu; Zou, Zhiyuan; Larsson, Erik; Bergö, Martin O; Lindahl, Per. The MTH1 inhibitor TH588 is a microtubule-modulating agent that eliminates cancer cells by activating the mitotic surveillance pathway. Scientific Reports. 2019;9(1):14667.  PubMed