Anti KIF1C pAb (ATL-HPA045020)

Atlas Antibodies

Catalog No.:
ATL-HPA045020-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kinesin family member 1C
Gene Name: KIF1C
Alternative Gene Name: SAX2, SPAX2, SPG58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020821: 71%, ENSRNOG00000031364: 72%
Entrez Gene ID: 10749
Uniprot ID: O43896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QAHICKLMGILQQVKLQNSSKDWELQALQDRMVCMERIIPLAQDHEDENEEGGEFHWA
Gene Sequence QAHICKLMGILQQVKLQNSSKDWELQALQDRMVCMERIIPLAQDHEDENEEGGEFHWA
Gene ID - Mouse ENSMUSG00000020821
Gene ID - Rat ENSRNOG00000031364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF1C pAb (ATL-HPA045020)
Datasheet Anti KIF1C pAb (ATL-HPA045020) Datasheet (External Link)
Vendor Page Anti KIF1C pAb (ATL-HPA045020) at Atlas Antibodies

Documents & Links for Anti KIF1C pAb (ATL-HPA045020)
Datasheet Anti KIF1C pAb (ATL-HPA045020) Datasheet (External Link)
Vendor Page Anti KIF1C pAb (ATL-HPA045020)