Anti KIDINS220 pAb (ATL-HPA014790)

Atlas Antibodies

Catalog No.:
ATL-HPA014790-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: kinase D-interacting substrate, 220kDa
Gene Name: KIDINS220
Alternative Gene Name: ARMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036333: 92%, ENSRNOG00000023176: 94%
Entrez Gene ID: 57498
Uniprot ID: Q9ULH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
Gene Sequence EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
Gene ID - Mouse ENSMUSG00000036333
Gene ID - Rat ENSRNOG00000023176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIDINS220 pAb (ATL-HPA014790)
Datasheet Anti KIDINS220 pAb (ATL-HPA014790) Datasheet (External Link)
Vendor Page Anti KIDINS220 pAb (ATL-HPA014790) at Atlas Antibodies

Documents & Links for Anti KIDINS220 pAb (ATL-HPA014790)
Datasheet Anti KIDINS220 pAb (ATL-HPA014790) Datasheet (External Link)
Vendor Page Anti KIDINS220 pAb (ATL-HPA014790)