Anti KIAA1456 pAb (ATL-HPA024673)

Atlas Antibodies

Catalog No.:
ATL-HPA024673-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: KIAA1456
Gene Name: KIAA1456
Alternative Gene Name: C8orf79, FLJ36980
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039620: 69%, ENSRNOG00000011253: 70%
Entrez Gene ID: 57604
Uniprot ID: Q9P272
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTL
Gene Sequence HPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTL
Gene ID - Mouse ENSMUSG00000039620
Gene ID - Rat ENSRNOG00000011253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1456 pAb (ATL-HPA024673)
Datasheet Anti KIAA1456 pAb (ATL-HPA024673) Datasheet (External Link)
Vendor Page Anti KIAA1456 pAb (ATL-HPA024673) at Atlas Antibodies

Documents & Links for Anti KIAA1456 pAb (ATL-HPA024673)
Datasheet Anti KIAA1456 pAb (ATL-HPA024673) Datasheet (External Link)
Vendor Page Anti KIAA1456 pAb (ATL-HPA024673)