Anti KIAA0040 pAb (ATL-HPA016895)

Atlas Antibodies

Catalog No.:
ATL-HPA016895-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA0040
Gene Name: KIAA0040
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 25%, ENSRNOG00000019799: 29%
Entrez Gene ID: 9674
Uniprot ID: Q15053
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIH
Gene Sequence MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIH
Gene ID - Mouse ENSMUSG00000054976
Gene ID - Rat ENSRNOG00000019799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA0040 pAb (ATL-HPA016895)
Datasheet Anti KIAA0040 pAb (ATL-HPA016895) Datasheet (External Link)
Vendor Page Anti KIAA0040 pAb (ATL-HPA016895) at Atlas Antibodies

Documents & Links for Anti KIAA0040 pAb (ATL-HPA016895)
Datasheet Anti KIAA0040 pAb (ATL-HPA016895) Datasheet (External Link)
Vendor Page Anti KIAA0040 pAb (ATL-HPA016895)