Anti KHSRP pAb (ATL-HPA034739)

Atlas Antibodies

Catalog No.: ATL-HPA034739-25

Protein Description: KH-type splicing regulatory protein
Gene Name: KHSRP
Alternative Gene Name: FBP2, FUBP2, KSRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007670: 100%, ENSRNOG00000047628: 100%
Entrez Gene ID: 8570
Uniprot ID: Q92945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEI
• Gene Sequence: PERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEI
• Gene ID - Mouse: ENSMUSG00000007670
• Gene ID - Rat: ENSRNOG00000047628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KHSRP pAb (ATL-HPA034739) – 3 Found

Sun, Yulin; Zheng, Weiwei; Guo, Zhengguang; Ju, Qiang; Zhu, Lin; Gao, Jiajia; Zhou, Lanping; Liu, Fang; Xu, Yang; Zhan, Qimin; Zhou, Zhixiang; Sun, Wei; Zhao, Xiaohang. A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. Scientific Reports. 2016;6( 27312428):28083. 

Bikkavilli, Rama Kamesh; Zerayesus, Sereke Adam; Van Scoyk, Michelle; Wilson, Lora; Wu, Pei-Ying; Baskaran, Abhinaya; Tang, Ke; Raheem, Syed; Samuelson, Blain A; Reddy, Narsa M; Reddy, Sekhar P; Cool, Carlyne D; Kosmider, Beata; Avasarala, Sreedevi; Winn, Robert A. K-homology splicing regulatory protein (KSRP) promotes post-transcriptional destabilization of Spry4 transcripts in non-small cell lung cancer. The Journal Of Biological Chemistry. 2017;292(18):7423-7434. 

Caiazza, Francesco; Oficjalska, Katarzyna; Tosetto, Miriam; Phelan, James J; Noonan, Sinéad; Martin, Petra; Killick, Kate; Breen, Laura; O'Neill, Fiona; Nolan, Blathnaid; Furney, Simon; Power, Robert; Fennelly, David; Craik, Charles S; O'Sullivan, Jacintha; Sheahan, Kieran; Doherty, Glen A; Ryan, Elizabeth J. KH-Type Splicing Regulatory Protein Controls Colorectal Cancer Cell Growth and Modulates the Tumor Microenvironment. The American Journal Of Pathology. 2019;189(10):1916-1932.