Anti KHDRBS3 pAb (ATL-HPA000981 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000981-25

Protein Description: KH domain containing, RNA binding, signal transduction associated 3
Gene Name: KHDRBS3
Alternative Gene Name: Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022332: 95%, ENSRNOG00000009539: 93%
Entrez Gene ID: 10656
Uniprot ID: O75525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
• Gene Sequence: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
• Gene ID - Mouse: ENSMUSG00000022332
• Gene ID - Rat: ENSRNOG00000009539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.