Anti KDM4A pAb (ATL-HPA007610)

Atlas Antibodies

Catalog No.: ATL-HPA007610-25

Protein Description: lysine (K)-specific demethylase 4A
Gene Name: KDM4A
Alternative Gene Name: JHDM3A, JMJD2, JMJD2A, KIAA0677, TDRD14A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033326: 84%, ENSRNOG00000019956: 88%
Entrez Gene ID: 9682
Uniprot ID: O75164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
• Gene Sequence: DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC
• Gene ID - Mouse: ENSMUSG00000033326
• Gene ID - Rat: ENSRNOG00000019956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KDM4A pAb (ATL-HPA007610) – 2 Found

Verrier, Laure; Escaffit, Fabrice; Chailleux, Catherine; Trouche, Didier; Vandromme, Marie. A new isoform of the histone demethylase JMJD2A/KDM4A is required for skeletal muscle differentiation. Plos Genetics. 2011;7(6):e1001390. 

Dikopoltsev, Elena; Foltyn, Veronika N; Zehl, Martin; Jensen, Ole N; Mori, Hisashi; Radzishevsky, Inna; Wolosker, Herman. FBXO22 protein is required for optimal synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine. The Journal Of Biological Chemistry. 2014;289(49):33904-15.