Anti KDF1 pAb (ATL-HPA028639)

Atlas Antibodies

Catalog No.: ATL-HPA028639-25

Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 93%, ENSRNOG00000055933: 94%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTVQISQETTADAIARKLRPYGA
• Gene Sequence: LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTVQISQETTADAIARKLRPYGA
• Gene ID - Mouse: ENSMUSG00000037600
• Gene ID - Rat: ENSRNOG00000055933
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KDF1 pAb (ATL-HPA028639) – 2 Found

Lee, Sunjin; Kong, Yong; Weatherbee, Scott D. Forward genetics identifies Kdf1/1810019J16Rik as an essential regulator of the proliferation-differentiation decision in epidermal progenitor cells. Developmental Biology. 2013;383(2):201-13. 

Li, Yuanyuan; Tang, Liangfeng; Yue, Jiping; Gou, Xuewen; Lin, Anning; Weatherbee, Scott D; Wu, Xiaoyang. Regulation of epidermal differentiation through KDF1-mediated deubiquitination of IKKα. Embo Reports. 2020;21(5):e48566.