Anti KDELR2 pAb (ATL-HPA016459)

Atlas Antibodies

Catalog No.: ATL-HPA016459-25

Protein Description: KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2
Gene Name: KDELR2
Alternative Gene Name: ELP-1, ERD2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022211: 29%, ENSRNOG00000009491: 28%
Entrez Gene ID: 11014
Uniprot ID: P33947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK
• Gene Sequence: YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK
• Gene ID - Mouse: ENSMUSG00000022211
• Gene ID - Rat: ENSRNOG00000009491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.