Anti KCTD9 pAb (ATL-HPA047902)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047902-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KCTD9
Alternative Gene Name: BTBD27, FLJ20038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034327: 92%, ENSRNOG00000012951: 92%
Entrez Gene ID: 54793
Uniprot ID: Q7L273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV |
Gene Sequence | NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV |
Gene ID - Mouse | ENSMUSG00000034327 |
Gene ID - Rat | ENSRNOG00000012951 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KCTD9 pAb (ATL-HPA047902) | |
Datasheet | Anti KCTD9 pAb (ATL-HPA047902) Datasheet (External Link) |
Vendor Page | Anti KCTD9 pAb (ATL-HPA047902) at Atlas Antibodies |
Documents & Links for Anti KCTD9 pAb (ATL-HPA047902) | |
Datasheet | Anti KCTD9 pAb (ATL-HPA047902) Datasheet (External Link) |
Vendor Page | Anti KCTD9 pAb (ATL-HPA047902) |